DPCstruct | MC11812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 148 ± 20 aa |
| Standard deviation of domain lengths | 20.33 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3RX87 | 6-138 | FRVNGTLGVRLRDALRYPTTHNIQGLYDPNALPILSHTSLRVTIRIQWPGYESWTDPNGIHQYDHGYEANLRNRQHIAWQVARSVKT… |
| A0A0D2MW26 | 242-404 | QPMYKPHTTSDRKRYVEEVLLEAPLFFISEHAQQYGIPLKDALHFRTKKLRDRDQVVFEGRGPSVSIRLEWPGYRQWSRQIPTKDFR… |
| A0A165Y4F1 | 119-285 | None |
| A0A165Y9K4 | 504-646 | None |
| A0A166BJ11 | 105-232 | None |
| K5VT41 | 9-171 | None |
| A0A1B7MUH7 | 69-219 | None |
| A0A5C9EHG9 | 18-166 | None |
| A0A4Q9N3W2 | 7-136 | None |
| K5VTZ9 | 461-608 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.