DPCstruct | MC11811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 77 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 55.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0UE18 | 362-436 | IKDGTEGTASGDGLQQLLAQTGASDTSRFYKAARMYNSGSVDPSGDLGKGVATHCYASDIANRLTGWVKATTLCT |
| A0A0D9NR36 | 1-89 | MISEGTAGTDDGDGLENCMNGAGGGDVAAFYRAARIYNSGSVSSTGQLQDGIATHCYASDISNRLTGWVGAASECTCDSDPGSCGIK… |
| A0A8A3P0P4 | 170-248 | None |
| A0A4U0WQB8 | 27-98 | None |
| A0A2T3B0M7 | 174-256 | None |
| A0A3M7D8Y9 | 820-894 | None |
| A0A2H4SR74 | 273-345 | None |
| A0A2H1H922 | 1-78 | None |
| A0A1Q5UAF2 | 91-176 | None |
| A0A3M6ZEF9 | 551-625 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.