DPCstruct | MC11810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Standard deviation of domain lengths | 9.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3ND44 | 116-217 | EYVDAGECADLILTDDGKLPLSASNSMNYLASCLDQPSSWVAKNYQLWNVLDPVCQWGCDEKCTLDWPNANQADCPSGLGTAKVLTD… |
| A0A0D9NHG3 | 6-104 | VPADRCKPLLFDGKLPLSAPNSMGYVGHCLMEENSWVARNYELINIFDSTCHLGWNEVCTLDMDVSNQPACPNTLGEALPLAGLAVT… |
| A0A4Z1L255 | 346-445 | None |
| A0A163D3I8 | 136-242 | None |
| A0A0P7AW22 | 397-497 | None |
| A0A151GBC7 | 210-309 | None |
| T0L5G6 | 125-223 | None |
| A0A0F8A4M2 | 337-447 | None |
| A0A0G4L6N8 | 281-382 | None |
| A0A179IAC3 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.