DPCstruct | MC11809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 171 ± 15 aa |
| Standard deviation of domain lengths | 15.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2RGM8 | 79-242 | SLNICGPITILSLLIDLKYFYKSVRKKDTVILDVMKILEDNIVNYAIRGYRCGAKIISYSDPVGDITIVGPKVYKEVVLNSTLNIIK… |
| H1LW13 | 1-199 | MTTDLCDCNVEVFENNSLYNENVYELDGILQSFDNENSLNLVYRYILKYNSLPDDTRLKLQIKLDTVVDGLIDEAKNALNSGYKIIS… |
| K1LQZ6 | 83-224 | None |
| A0A7C6NBZ5 | 226-403 | None |
| A0A6I2V123 | 230-409 | None |
| A0A1M6IHJ3 | 691-852 | None |
| A0A3D1M5U6 | 85-274 | None |
| A0A7S7IZQ3 | 119-284 | None |
| A0A0F2JD83 | 1-166 | None |
| A0A369XTV9 | 72-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.