DPCstruct | MC11807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Standard deviation of domain lengths | 6.04 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 66.83 |
| Pfam Score | 84.62 |
| Assigned Pfam label(s) | CL0023- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3MB52 | 1-58 | MPKFFCDYCDVYLTHDSMSVRKAHNSGRNHLRNVVDYYQQIGHEKAQSVIDSITSSYA |
| A0A818LZK3 | 1-58 | MPKYYCDYCDTYLTHDSPSVRKTHCQGRKHKENVRDYYQKWMEEQAQKLIDQTTAAFK |
| A0A183HKV6 | 4-63 | None |
| E9FTV3 | 1-63 | None |
| A0A654HR11 | 47-104 | None |
| A0A821HY26 | 2-66 | None |
| A0A5B0QM47 | 58-115 | None |
| A0A843UT05 | 226-283 | None |
| A0A3P8YXU5 | 2-66 | None |
| A0A7J6E304 | 492-548 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.