DPCstruct | MC11806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 348 ± 98 aa |
| Standard deviation of domain lengths | 98.48 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 74.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 17.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0435 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3MB30 | 2-385 | MLQAIFYARFHPERGPSIVHQYPDHSIISPNSSDDHPPPILTWADISAYIIPPYDVCNRPLAICTNDVRVIALPVSLEDAKYARNRF… |
| A0A850MRJ8 | 5-355 | IDEVAGEIMNEMEKLLLERVYIAILREGSVLYASTALDKHIELLKLFVITEFKQMNNFDHHFPLPGTNLAIFNIENILVALYTKKGY… |
| B0EEK5 | 25-323 | None |
| A0A177B7U4 | 25-440 | None |
| A0A7S2KE34 | 2-248 | None |
| A0A1S8W960 | 323-627 | None |
| A0A044SME1 | 200-450 | None |
| A0A1X2GDC3 | 2-247 | None |
| A0A218Z147 | 727-1020 | None |
| A0A850LWC7 | 25-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.