DPCstruct | MC11804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7APM9 | 127-208 | LPPLKALRVHNPKRAVENPCIAIMSSVLACWASAGFNATGCAAVENQLRRCMDGPAAPPAPANTINYHLARMQKYMTSPKKQ |
| A0A6J3M2D4 | 1-82 | LPPLPKLTIRRPVEANANPCLTIMATMLGCWASNGHTSTSCASLETNLRSCMDARKPAASQRSPINSQLSRLYPQIRGPYKR |
| A0A4P6XPJ0 | 31-117 | None |
| A0A3N2PUV1 | 48-141 | None |
| A0A0J9XJ82 | 8-92 | None |
| A0A168C971 | 8-77 | None |
| A0A5M9K101 | 64-159 | None |
| T5BGX2 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.