DPCstruct | MC11801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 213 ± 24 aa |
| Standard deviation of domain lengths | 23.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3LYL8 | 3-197 | RSDERTAKTSPRAKASEHFSAFQSFCPPKPQPPATWLRPDEAKSLYKTYTEKWAALGPTDPNVPFPGRGLNARSLSKRDSLYAPNIS… |
| R7YV57 | 1-155 | MPPSSHAEAKRQFEEYSKCWARLSHRDPAIPYPTAGQRADELLDRSRLGASLDHSTWTDALVMESNTALFFLRAFGFRPQFVADGTG… |
| A0A139GZ90 | 384-596 | None |
| A0A4Z1P473 | 52-295 | None |
| A0A4U0WM69 | 114-346 | None |
| A0A132B824 | 293-532 | None |
| A0A2V1BWW3 | 501-712 | None |
| A0A1Y6LMN0 | 931-1143 | None |
| A0A6G1KW74 | 32-208 | None |
| F9XEA8 | 76-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.