DPCstruct | MC11800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 147 ± 20 aa |
| Standard deviation of domain lengths | 20.47 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4QJ93 | 3-155 | MAHDRVVGFYEDPVDSFSRPVNVVESWAAYHFEVHARKRAYCHNSYEVYRNRENLCEVGHGLAQQIARYIYMKPGGEIYSTIEEDNK… |
| A0A6J3LVA0 | 1-146 | MKLSNSVRFPEDPLTMISRQPTLLEMSVLEDFECHARQCRDCQTARHLTSFIPPDLCPRGFNYARDLTRLFYSASDGNIYSTTATTT… |
| A0A1V8V2X3 | 105-300 | None |
| A0A6A5Z9A5 | 137-291 | None |
| C4JGF8 | 114-259 | None |
| A0A6A5V9D6 | 4-158 | None |
| A0A6A6AJW8 | 41-196 | None |
| A0A2T2N8Z3 | 112-257 | None |
| A0A0D2BF81 | 8-129 | None |
| A0A150URQ0 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.