DPCstruct | MC1180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 395 ± 20 aa |
| Standard deviation of domain lengths | 20.07 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 70.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14648- PF14647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0IMV8 | 217-602 | DLDYKLVTSLYTKGFIYLEVPIHEDDHVVLPPLEGFVMNRVLGDYIENLLYKIFVSIDERTSVGELASVLQIDLQLVKNVVSLYCRL… |
| A0A3S5BLU9 | 1-385 | MAVKDCDMDTLLSLHRRGLIYFDVPVSESDRISVPTLDGFVMNRITGDSCETLLYKIFVSVDERTTVSELASDLLVNIDLVRQAISV… |
| A0A0N4UB38 | 750-1172 | None |
| A0A6A4WR79 | 1-374 | None |
| A9V2F8 | 209-603 | None |
| A0A813T2E5 | 214-637 | None |
| A0A5A9NQJ8 | 145-543 | None |
| G5BAU0 | 135-507 | None |
| A0A0C2CMJ8 | 1-354 | None |
| A0A3P7DQ80 | 312-732 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.