DPCstruct | MC11799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 94 ± 4 aa |
| Standard deviation of domain lengths | 3.98 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 49.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0M3N5 | 16-102 | QEMELRTRPQTGRTIHVTGSRDFSAAIKALEVSTKRNRIKSLWHGQKFHERPGMRRKRLRRERSVKRYKEGFVATVRRVQELTNQGW |
| A0A6J3LUM4 | 1-85 | LKLGPNVGRSFHVDAGRGLDVARAFRNLDTACKRNKVRTDFLKQRFHERPGLKRKRIRYEGKIRGFKARFTKVVQMVQSMTKSGW |
| A0A4Q4XBQ1 | 148-242 | None |
| A0A6A6CG07 | 50-147 | None |
| A0A1Y6LN21 | 81-176 | None |
| A0A2T2ZZZ2 | 23-116 | None |
| A0A1Z1CCL4 | 193-289 | None |
| A0A1Y2TKH5 | 98-194 | None |
| A0A074XJK8 | 150-244 | None |
| A0A4Q4VTW6 | 222-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.