DPCstruct | MC11798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 184 ± 29 aa |
| Standard deviation of domain lengths | 28.59 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B0DMI3 | 84-241 | KQPPIEELVYGYMFPKARPSDPPNFSVFLQRHLIYEVRQEVHSYYGHIDTQEAKYPGLDYNHPIHRIRLSRWTWHRRLFRAFDALRL… |
| A0A6J3LTU0 | 1-217 | MRRQAPIATLLYNHIFPEPKQGDPQNFSTHLARNLVPEVRIEVNLYYGDLNSAEARYPGLNYCHRAHRMRLGRFPHHRRLFDAFDEL… |
| A0A232LW33 | 1-221 | None |
| A0A6A6U9D2 | 2-202 | None |
| A0A0G4MGA5 | 1-150 | None |
| L7J189 | 1-195 | None |
| M1W719 | 1-167 | None |
| A0A3N4KUK7 | 1-142 | None |
| A0A218YV72 | 1-172 | None |
| A0A6G1IRV3 | 1-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.