DPCstruct | MC11794
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 87 ± 16 aa |
| Standard deviation of domain lengths | 15.51 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6ZEK4 | 5-80 | LHICCAPCSIMCIKKLREEDIDVTGFWYNTNIHPYMEYKARRDTLKKYSEMINLNVIYKDEYGLREFTKNTINILD |
| A0A3D0MRM6 | 2-62 | LHICCAPDATIPWPALAEEGYDVTGYFYGHNIHPVEEYIQRRVAVERLASLLFCPVVIEEY |
| R5FW36 | 173-264 | None |
| A0A0F8WVQ3 | 7-82 | None |
| A0A4U8Q6R5 | 211-304 | None |
| A0A0G0MYD7 | 12-94 | None |
| A0A1H5YJV1 | 19-120 | None |
| A0A2X4NCQ4 | 34-145 | None |
| A0A379AAL6 | 14-110 | None |
| A0A7Z7PP07 | 3-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.