DPCstruct | MC11793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432I7M4 | 2-63 | FEYICYCDKVTKGDIVMAVMGGAKTLQDVMKVTGAMKSANCAVNNPSGKCCGNDIKEVIKMY |
| A0A3D0MRB2 | 1-83 | MNWKEAHQETTVCYCKNVNKQQILRAITNGAKTLQDIQSMTGACTGNQCATLNPSGICCSKDINELLAIYIPIFEKLSSGNCG |
| A0A7X7U0I0 | 25-102 | None |
| A0A4Z0YD02 | 2-65 | None |
| A7B5S8 | 1-72 | None |
| K2DBI4 | 7-82 | None |
| A0A2G6FYM5 | 1-76 | None |
| A0A644WUF0 | 13-81 | None |
| A0A0S3QVN3 | 6-76 | None |
| A0A7J0BMR1 | 9-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.