DPCstruct | MC11789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 94 ± 14 aa |
| Standard deviation of domain lengths | 13.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A512UBU5 | 4-93 | SWADAEDDIPTPEVTNNSDGTKTVVSYRLNANGQKVKITQKIKEVKVKERVHPSIAIRRGWSKYGKEKHTPAGPDTRTTQLGEKVEL… |
| W1P9Y2 | 4-106 | KFRWGELDEEDTEDLDVFLPPPQVEGPDENGIKKVTEFKINEDGKKVQNVTTIRARRLVVRISKRAIERRQWKKFGDADHEDANSRL… |
| A0A5N6NH05 | 5-87 | None |
| A0A2H2IF43 | 1-101 | None |
| A0A1J3HML4 | 4-112 | None |
| A0A835GXM0 | 11-124 | None |
| A0A182FCR6 | 311-404 | None |
| J6F5G0 | 5-102 | None |
| A0A817B984 | 26-93 | None |
| A0A1E5UPT7 | 26-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.