DPCstruct | MC11787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 139 ± 19 aa |
| Standard deviation of domain lengths | 18.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 47.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B0MKW6 | 134-239 | YSPLGNLLILQPNAKSSPGHPLLPPGTAFYALDTTGCKDTSNAAINGFLNSPRPLQTLFDPKAYGDDGTVSLNHDSSSYLKAINGVL… |
| W1NY64 | 1-135 | MGQSLILQPDEKVSPPHPLLPPGSALYALERGPQVQAALRTFLNTPHPLETLSDPTAYGSEGSILRDHDSSNYLKAINAVLRQQTKQ… |
| A0A833VST8 | 557-727 | None |
| A0A426ZHX1 | 147-290 | None |
| A0A0B2QD82 | 522-659 | None |
| C0HEF7 | 218-353 | None |
| A0A5E4EHD9 | 283-401 | None |
| A0A2P5DTH1 | 9-140 | None |
| A0A2U1P6L7 | 341-478 | None |
| A0A251TGI1 | 404-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.