DPCstruct | MC11786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 111 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4AW11 | 20-122 | PEFAESETLKFKTELWHKLLKDKETFGDDLDHVVEVCTEIFGEFLHKEYGGPGTLLVEPFTDMLIALKERKLPGAPLAARISLLWAQ… |
| W1NY04 | 15-116 | PEFAQAETEKFRDHLLKKLSEDQDDIFGEYYEEVVNVCTEIMSTFLHKEYQGPGTLLVIPFIDMADTVKERALPGGPEAARAAVVWA… |
| A0A6S7MIV9 | 50-185 | None |
| A0A6V7P709 | 159-261 | None |
| A0A2R6XDF8 | 49-162 | None |
| A0A4Y1QQJ1 | 333-444 | None |
| A0A5P1ETZ3 | 6-108 | None |
| A0A6G1DSL5 | 119-225 | None |
| A0A287REH0 | 3-87 | None |
| A0A444GE08 | 48-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.