DPCstruct | MC11785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 121 ± 16 aa |
| Standard deviation of domain lengths | 15.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.92 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 61.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0235 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3Y9T2 | 4-100 | MDPTKQAKVMQDFQRQSAQLDMTTEMMSDAIDDAIDNDEAEEETEDLTNQVLDEIGVDVASQLSTAPKGKVIGKRIEESSSSGIDEL… |
| W1NVH7 | 1-121 | MYANTSVAAGMKGASKAMAAMNKQMAPAKQAKVLQEFQRQSAQMDMTSEMMSDAIDDALDKDEAEEETEELTNQVLDEIGVDIASQL… |
| A0A498JUH0 | 56-203 | None |
| A0A5D2C3D6 | 11-131 | None |
| A0A0E0GQY2 | 37-174 | None |
| A0A287SA28 | 1-98 | None |
| A0A5N5JW07 | 39-162 | None |
| A0A452YFE4 | 1-121 | None |
| A0A7S2T9Q3 | 3-108 | None |
| A0A453LR30 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.