DPCstruct | MC11784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 69 ± 4 aa |
| Standard deviation of domain lengths | 4.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 68.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8IPG0 | 60-123 | KRKTVASYRELEARKSRVNKLKKLYMEMSLKKELQKKGRKWKLREDELVCPTSKPVYKWRSERK |
| W1NT53 | 5-79 | VLWITGLSSTSRKTAASYKELAARKKRAYDLEKMYMEMAYQKELKKKGQKRRVKDHELVSPTDRPVYKWERERKR |
| A0A200QTI0 | 162-229 | None |
| A0A4D6LUU3 | 119-185 | None |
| A0A6A1VJN0 | 61-129 | None |
| A0A3P6C7X1 | 71-137 | None |
| B4FXT4 | 9-79 | None |
| A0A2Z6M5I2 | 57-120 | None |
| V4T2F4 | 99-163 | None |
| A0A4S4DNY7 | 232-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.