DPCstruct | MC11782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 216 ± 32 aa |
| Standard deviation of domain lengths | 32.40 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 34.08 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0266- CL0255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7LB22 | 6-171 | TIKIPERHPKVRLGFLPDSWFHALYSRTGVTGPYLFLTGSVAFLLSKEIWVVDAHFMEIIPFVVIMTWMIKTFGARASDFIDQFTQA… |
| A0A2H1WII3 | 14-223 | QSTALVARTSATDVSGVRDEKNFPRPVRALEPGKVRLGFIPEEWFQFFHSKTGVTGPYTFGVGLTTYLFSKEIYVMEHEYYTGLSLL… |
| J9JY01 | 171-352 | None |
| A0A2T7P6X8 | 59-297 | None |
| T1GN28 | 48-201 | None |
| A0A8B6F178 | 22-283 | None |
| A0A4U1EIC7 | 65-330 | None |
| A0A3M6UD64 | 8-237 | None |
| A0A3P8GYY2 | 2-213 | None |
| S9X9N2 | 31-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.