DPCstruct | MC11781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 13.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 35.55 |
| Pfam Score | 88.51 |
| Assigned Pfam label(s) | CL0129- PF07966 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7J4J4 | 16-136 | EVNLLEAMHSLIFLMAIVGCAMAAVHIMKVKRFTPPMVKMIRSGIWDQFVEKLKEKRLQRMLNNAADIHIHDINGYYDIEYLAEITI… |
| A0A2H1WI40 | 77-179 | KLLLLFLALAATSVCGFLRVPLYRMKTVRKHFQEVGTDLQVLRIKYAVSGPAPEPLSNYLDAQYYGPISIGSPPQTFKVVFDTGSSN… |
| A0A0D6LUJ8 | 1-108 | None |
| A0A1D6NTJ5 | 57-168 | None |
| A0A0B1SKD0 | 1-107 | None |
| A0A426Y9P0 | 9-126 | None |
| A0A5E4A885 | 1-99 | None |
| A0A6P7GR17 | 11-100 | None |
| A0A368FRG4 | 43-152 | None |
| A0A834V5U8 | 7-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.