DPCstruct | MC1178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 3.60 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 72.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183Q5B9 | 76-137 | MALTSVHDARKAGAEVVKQVSNPLVSGLLYPLLQALDEVHLKVDIQFGGVDQRKIFMLAEKV |
| A0A3S5BG10 | 7-66 | SASVSVHDARKAGAEVVKQVANPLVSGLLYPLLQALDEEHLGVTAQFGGVDQRKIFMLAE |
| A0A6V7V2E2 | 33-93 | None |
| A0A395TAA0 | 135-194 | None |
| A0A4Q4X819 | 135-193 | None |
| L8HDT0 | 155-214 | None |
| A0A6L2PCV1 | 232-291 | None |
| A0A6P7U1I9 | 220-280 | None |
| A0A0C9XJ62 | 58-129 | None |
| A0A1X7TN17 | 2-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.