DPCstruct | MC11776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 126 ± 9 aa |
| Standard deviation of domain lengths | 8.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536E9L2 | 60-172 | LVLPIENSLLYIEPIYLEATNVPIPQLKKVIAATGQNVVMEDTLDKALASLLGNATPTTPSGPTTPPSGTVAQLIASAKTHYDQAQT… |
| A0A1Y1RZS8 | 1-126 | MLVLPLNGTLLYVEPIYLQSETAAYPELRMVVLMHKDTMVYAETLDSALEKLYAAGSEAEAETGQSKTVTATASGDASGKEKQELIR… |
| A0A3D2RTH5 | 463-609 | None |
| A0A358II29 | 334-456 | None |
| A0A7V9TI54 | 585-705 | None |
| A0A7K0SVD2 | 110-232 | None |
| A0A6L7WS05 | 237-360 | None |
| A0A7K1CF93 | 1-121 | None |
| A0A2V2PUV2 | 567-692 | None |
| A0A7C7P099 | 157-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.