DPCstruct | MC11775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 155 ± 15 aa |
| Standard deviation of domain lengths | 14.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7NEU7 | 7-152 | SMYANWKIQTPEILKELRWYSVSQLIHYLHQARSFIISQQWSRRIYPPVVACCKLPAGKEERFPLNDGYVCESIGHWHSTLDVIQLN… |
| Q9W483 | 102-259 | MSLLTVKGGRYLWTDRELLMHLQNYTPLILLIDFVEKTRTKRFYESSERYEILMLVFIMRKGAPFCENKRFPAEYWVNLSVGPIAEA… |
| A0A0B7N3J9 | 2-164 | None |
| A0A427A1H1 | 27-167 | None |
| I1BUM2 | 1-148 | None |
| A0A835F664 | 31-188 | None |
| S2JP88 | 19-157 | None |
| A0A811PJ58 | 54-216 | None |
| A0A1I8NI69 | 236-410 | None |
| A0A168J4K8 | 18-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.