DPCstruct | MC11774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 210 ± 26 aa |
| Standard deviation of domain lengths | 25.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9VJ72 | 164-413 | TLPMRGSASGAGRSKRQDDQSFIMSADKWEDLSVPGELKELFPYIVKYTPQTIDTPFHLQPFIPEFVPAVGDVDALLKVQAPPLLQP… |
| A0A3P7Q8P9 | 39-236 | KSSIDDIEIFEYINAYKPENIEIKFLLKPFLLDYIPAIGDVDTFIKIPRPDGDNLGLTVLDEPAIQQSDPTIVGMQLRNECKEIKTE… |
| A0A3P7HF70 | 56-281 | None |
| A0A2R7WH58 | 61-233 | None |
| A0A1I7V6H4 | 50-223 | None |
| A0A7S1SL40 | 13-216 | None |
| A0A2A4JU25 | 285-521 | None |
| A0A4Y7LLR3 | 18-208 | None |
| A0A397F651 | 449-680 | None |
| A0A177WK28 | 239-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.