DPCstruct | MC11772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 7.60 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13164 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4EUY1 | 15-114 | FIRNATSECCNMHSQLLYSIQGEPCEAVGGQEDHLDPELCTICICGDGKKVDGLYCGEGNCDDFGCNCPGGCRKGNWHYEIVERNKQ… |
| Q9VAK8 | 5-115 | VVSLLLVGICALAFVHVARSECCTSRELVEFKMDRGDCEAVRAIENYPNGCEVTICADGVAQLGAYCGQGSCNIFGCNCDGGCLSGD… |
| A0A6P4I175 | 16-127 | None |
| A0A0B4K6M8 | 4-107 | None |
| A0A6P4IIW2 | 16-123 | None |
| T1GZE7 | 3-109 | None |
| B4KZ86 | 2-116 | None |
| J9K489 | 3-118 | None |
| A0A1W4WAC3 | 122-231 | None |
| T1GZ44 | 106-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.