DPCstruct | MC11771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 114 ± 14 aa |
| Standard deviation of domain lengths | 13.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4VHF2 | 1-105 | MTGPFLICDLRPEWNWRPYVTFWRPNNANYAYPLVWSGDYTEAEVMKGGSYYTTVESGILIRFPVLRSLVEPMAVAPDRGHIDGDTG… |
| A0A2T6F2L4 | 269-386 | NSYYVLSLKHTNRTDAHITLWGQSGCGYRYSIAAAGKYSRDEIMAHLGHYNGGDNIAVDAETVERLVTMCDKTDRDLERQAPTLRNT… |
| A0A2S1L9P8 | 14-104 | None |
| A0A7U7FKI9 | 88-206 | None |
| A0A495D3U7 | 1-132 | None |
| A0A4R1J574 | 2-120 | None |
| A0A285THD1 | 1-116 | None |
| A2WAG5 | 140-247 | None |
| A0A2E4PPK3 | 2-85 | None |
| A0A0Q0CVR2 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.