DPCstruct | MC1177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 171 ± 17 aa |
| Standard deviation of domain lengths | 17.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821M7B2 | 1-157 | MENRLRLGQFVTQRQGATFVENWTDGTAFSDISKQQEMIQRAREELDRERRNLVRRRPNCEVKEKTPKTPNSKSRTKDRTGAFILQD… |
| A0A673H385 | 183-351 | QDRLRLGHFTTVRHGASFTEQWTDGYAFQNLVKQQERVNGQREDIERQRKLLMKKKPPNASQTPPPNLEPNKRKSKSNGAENEMLSL… |
| A0A0L0D5Z6 | 337-531 | None |
| A0A7J8JML0 | 78-228 | None |
| A0A2I3MJP0 | 199-350 | None |
| A0A0S7KGY5 | 85-266 | None |
| A0A3P8HAR6 | 126-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.