DPCstruct | MC11769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 134 ± 14 aa |
| Standard deviation of domain lengths | 14.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15565 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J6PH80 | 7-104 | SRQLKIVYTNRLLQSPKEVSSFEEALGNLIGLGDISVITGLCMGFDDDTEQYEIMFGLVHGIEHLYKENIEEGLYLIALAVPSVIDR… |
| A0A2L2NV45 | 3-132 | QNNLLAILRENRLMQTQQQVTDFENALAEIADNPDEQNLSAYHLVLDDQCQQPEVMFSLIHFLESFDIEGQITAFIKVVPQLMINAP… |
| A0A7Y4N967 | 88-231 | None |
| H7ELC1 | 1-129 | None |
| A0A7X0QC45 | 1-146 | None |
| A0A1H2YI06 | 18-155 | None |
| A0A3E0NTN9 | 130-276 | None |
| I0GQV0 | 14-156 | None |
| A0A7X6HNW1 | 1-130 | None |
| A0A7G5P2H1 | 3-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.