DPCstruct | MC11768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 12.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08872 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4RNV7 | 1-88 | MDNADRIINNNEVVSISNHEDNVLISHNTYTSEEFLDRLGEHINRHKKHKWIVEGVPCKLLSPNQSWQKGKVKICLQFIPDKKESILD |
| A0A2L2NSI2 | 33-140 | SFDDEDVVSGFSCPAFDMPPMLKFRNLIQAIFSWIGGKNSYSNAESQWFSEEGCKCEILLVKGGGWQKGRFRFRLEFIPDNPEAFLK… |
| A0A2A2TLL5 | 1-106 | None |
| A0A3M1PB96 | 9-116 | None |
| A0A6P1AI71 | 1-101 | None |
| A0A7C3VW61 | 1-111 | None |
| A0A0D6AME8 | 1-102 | None |
| A0A845ZKJ7 | 1-96 | None |
| A0A350XA44 | 1-83 | None |
| A0A4P8WZG6 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.