DPCstruct | MC11763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 10.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A6DJX7 | 469-554 | DSSNLQGKDNLMVYRDGDKATSVGGYNGQDSVKTFLSDYIDKDGYVTIGADQVIFLMELGTTNKSKSYYDMQDLVVLATFEVVATE |
| A0A847HQW2 | 72-152 | MAQSERFVWALRDGDTVPDVSSMAQQASIESFLRDYINAETGTVMLPDNQVIYLFELGTANLQSDAADYQDLVVLVSLHQV |
| A0A0E3KQ67 | 1-91 | None |
| A0A3C1W8A5 | 38-122 | None |
| A0A1F9H9V3 | 421-532 | None |
| A0A6B0GND8 | 144-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.