DPCstruct | MC11762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 679 ± 114 aa |
| Standard deviation of domain lengths | 114.05 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.77 |
| Pfam Score | 46.74 |
| Assigned Pfam label(s) | CL0715- PF14744- PF14746- PF10266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7F222 | 199-837 | KSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPCEYLSLDAMEKWIVFGFILCHAALNSDAAALSLWKLAL… |
| A0A6M2DZN1 | 97-743 | KFLRTALKELGLILTDQPGLLGPKALLIFMGLCYARDEVYWLLRHHDNLPLQKGKNKSTDDMADRQLPELLFHMEELRILVRKYSQV… |
| B4HB68 | 10-515 | None |
| A0A438E335 | 58-755 | None |
| K1PKW3 | 485-1127 | None |
| A0A3Q4MTD8 | 16-591 | None |
| A0A5S6Q1S3 | 30-679 | None |
| A0A672V1X7 | 460-1153 | None |
| A0A811PK33 | 6-517 | None |
| A0A6U0K852 | 475-1210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.