DPCstruct | MC11761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 342 |
|---|---|
| Mean domain length (aa) | 74 ± 13 aa |
| Standard deviation of domain lengths | 12.63 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.14 |
| Pfam Score | 96.77 |
| Assigned Pfam label(s) | CL0451- PF01826- PF08742 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4ZL07 | 289-344 | PTNCPMDCPANSAYSPCTTACPASCPDPNPTCTEACVEGCVCNDGFILSGLECVPL |
| A0A6M2DZ88 | 8-84 | LILSAIFHSSLSYTMVMRHCAQNEEFKNCGSACESTCENPYPRICSAQCILSICQCVRGYARRSDGRCVPISQCEGN |
| A0A0D8Y000 | 32-106 | None |
| G0P761 | 305-362 | None |
| A0A821HB80 | 25-84 | None |
| A0A803JSD6 | 311-363 | None |
| A0A2G8LP77 | 100-177 | None |
| A0A2G8LBN9 | 115-182 | None |
| A0A2G8L685 | 168-230 | None |
| C3ZK78 | 247-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.