DPCstruct | MC11758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 224 ± 29 aa |
| Standard deviation of domain lengths | 29.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M2DM57 | 1-239 | MFNRNLKALNHPSPDKVDITSPAEFSSTVQWLEDQIIRFYKIEDRAPLRAKDPKEFQKAFMKYCKDLGCPHILQNNQQKLAWLLSHG… |
| A0A0C2GA17 | 16-227 | IDYDDDIDYKSFFCDADAMFFKKKSKEWWTAFKDETDEQKWSEELGKYLADCEVGVSTSQSRKVVANAVLDVIIAKKYDETASIHSL… |
| A0A1Q9DZ08 | 697-920 | None |
| A0A6A4KDH3 | 253-486 | None |
| A0A1I8F8K6 | 4-220 | None |
| A0A7R9DZE4 | 2-164 | None |
| R1EBT5 | 4-225 | None |
| T1JGD4 | 2-233 | None |
| D7G3K0 | 14-226 | None |
| A0A7S0TRU3 | 23-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.