DPCstruct | MC11757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 92 ± 17 aa |
| Standard deviation of domain lengths | 16.92 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0CVW5 | 1-72 | MSSEEEVLLSSLFFQKMKQLQALPIRNYLDQTVVPLLLQAMTEVAKVRPPNPIEFIANYLLQNNPEKAQARQ |
| A0A6M2DJI7 | 8-104 | KNANEETINNKVAPGSIPEQAVNVLAMDKEQELPQKKVRIDLQSLPTRQYLDQTVAPILLQGLMLLARERPPDPISYLAAYLLKNKT… |
| A0A0R3UJK0 | 1-63 | None |
| A0A1Y2B832 | 1-78 | None |
| G0R1T5 | 2-79 | None |
| A0A5K4F7J1 | 1-80 | None |
| B4KKN8 | 53-158 | None |
| A0A2V2WAD0 | 1-80 | None |
| A0A674CIS4 | 6-88 | None |
| A0A5N4A2Y4 | 13-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.