DPCstruct | MC11753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 3.72 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 58.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A1W480 | 37-105 | SLCMFQWVRHLQDGTGQYIEGATNPEYVVTVDDVDKLIAVDCIPMDDKGHQGELVRLFANHQNKIKCDP |
| A0A446JLE2 | 120-188 | RGCNFEWVRHFEDGSVKFIEGARQPTYVVTADDVDTLLAIEVQPLDDRKRKGDVLKIYANEQMRITCDP |
| A0A5N6PH08 | 38-106 | None |
| A0A453SW78 | 222-287 | None |
| A0A453SVV0 | 33-98 | None |
| A0A6S7LN50 | 158-226 | None |
| A0A1R3G1M7 | 516-584 | None |
| A0A803NDK0 | 73-143 | None |
| M8C1P7 | 1-80 | None |
| A0A5J5W0M6 | 366-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.