DPCstruct | MC11751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 156 ± 30 aa |
| Standard deviation of domain lengths | 29.79 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4J5G5 | 362-515 | LELPDFTELLSETIFKSGVLGKLLTTQKLDDHDIEGAIHLYYNIISQPCLVCKNLTDVELLRKYTLLHSLPLDKSLKIVRNFLISAT… |
| A0A287JF83 | 31-183 | FIELLSEAISKSGVLDKLLATQKLDDHDIEGAIHLYYNIISQPCVVCKNITDAELLHKYSVLHSLPLDKSCKIVREFLISATAKDCS… |
| A0A2P2MT46 | 33-177 | None |
| A0A212CM61 | 10-135 | None |
| A0A7R8X027 | 65-223 | None |
| A0A164YC08 | 462-642 | None |
| A0A2J8ADF9 | 93-284 | None |
| A0A7R9LQ32 | 122-249 | None |
| A0A2I2Y4H4 | 7-152 | None |
| A0A0F7SVP8 | 120-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.