DPCstruct | MC11750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 163 ± 13 aa |
| Standard deviation of domain lengths | 12.72 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 61.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7REQ1 | 1-159 | MADGDREWEIHLRSLSSAARDAPDPASDSSLLNSVTRLHDLCRDGEKSVDELVARVYPHLNKIFQRCASSISQSQTSNGLLLLTILQ… |
| A0A0D2ZWE6 | 1-147 | MNDQDGDWNYHLRILSNSARDSTDPASDPSVLQSVKKLHGFCKLENSDDLVARIYPQINKVFQRSVASLTQSETGTSKGLLLLAILQ… |
| A0A7J7N7D2 | 10-165 | None |
| A0A061F629 | 464-644 | None |
| A0A0D2Q2R1 | 1-162 | None |
| A0A0D2U3S3 | 1-146 | None |
| A0A0D2M8D9 | 5-163 | None |
| A0A388MEB4 | 61-242 | None |
| A0A0D9W9U6 | 316-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.