DPCstruct | MC11749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 190 ± 21 aa |
| Standard deviation of domain lengths | 21.47 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3BGV3 | 16-209 | KESVSSLLNQRLESVLESEKNANVVFDILEFLESDSEEELLHAIRTCSRLFGTLLERGELFVGQLPEEEDAFAASYSAEEKYKIWMR… |
| A0A287JAI4 | 38-218 | SSATASGTKKRKSKSGALTQEEVKSLGLELLSSRAHLNHAPTLLALLSPTAPLSIALEALISLQSFFEPLLPSIPSASAAAAVAAGG… |
| A0A445ASC2 | 2-203 | None |
| A0A2I0WYQ4 | 1-205 | None |
| A0A7R9MLF2 | 12-187 | None |
| A0A7J7H3E3 | 18-201 | None |
| A0A2Z6PU26 | 2-197 | None |
| A0A4S4CWD9 | 21-203 | None |
| A0A7J7MHF4 | 1-186 | None |
| A0A2K3L4N1 | 2-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.