DPCstruct | MC11744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 133 ± 15 aa |
| Standard deviation of domain lengths | 15.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520KS37 | 1-108 | MVANLRKYVPSFDITPEMIEGKYRWHSFLSLIFAISRKKNAKDWFTGTIISSTNVGPEHQLELYHIFPKAILKTSGDFKTHETDDIA… |
| A0A1M4SHQ4 | 63-204 | MIARWYWCGVFGELYGGAVETRFARDLPQVVEWIKGGALPDTITEAYFDPNRLLSLRTRNSAAYKGVHVLLMREGSKDFLSGVPIDL… |
| A0A841V984 | 2-145 | None |
| A0A6N7FPI8 | 23-167 | None |
| A0A6L3EX38 | 123-242 | None |
| A0A519CMT7 | 671-806 | None |
| A0A3M1TZ16 | 2-142 | None |
| A0A367QLY9 | 1-156 | None |
| A0A1V5FPE9 | 106-251 | None |
| A0A6N4V6N9 | 361-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.