DPCstruct | MC11741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 131 ± 6 aa |
| Standard deviation of domain lengths | 6.26 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2HKJ4 | 19-149 | MAVVIAAVAAALGGLRYVKSAKSTQGARGWSIVAQIRAEDAGCREAALDGAREALLRAARGSSCVHVLGHKAQPFMSTPVGFAAHLG… |
| A0A7S0B901 | 168-304 | FNSQASCAVSLVKAALEGFSCVVDVQIVEEGVECWAFTIKVRAEDMQRTEYVLTLAKEALLENAEKTPCVKVVGHRLAPFLPFPHGF… |
| A0A813K4W2 | 206-334 | None |
| A0A7S4S5J0 | 253-387 | None |
| A0A7S1FH05 | 1-129 | None |
| A0A812SDX8 | 197-337 | None |
| A0A7S1RD23 | 64-194 | None |
| A0A7S1RIX1 | 198-329 | None |
| A0A7S4SLH6 | 150-266 | None |
| A0A7S1AUA7 | 116-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.