DPCstruct | MC1174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 6.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 31.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G6Y211 | 3-61 | EEADRIEYICATCGGTAVTREAWAEWNVTAQTWVLCDIFDFAFCHLCHRETRLTARNAS |
| A0A2N3DFF4 | 249-318 | LSPNADLPLSLKPACRYCANDRIVRDACARWDADTGRWTLADVLVGDFCEACNADGDDLVRWVAADGAPA |
| A0A154R3F1 | 2-54 | None |
| A0A484UHF1 | 6-65 | None |
| A0A418YHP9 | 78-159 | None |
| A0A418YJG9 | 1-62 | None |
| A0A7W6PV32 | 5-74 | None |
| A0A7W6QU35 | 2-61 | None |
| A0A7W6BVF6 | 92-160 | None |
| A0A7H8PT22 | 70-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.