DPCstruct | MC11738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 5.77 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03513 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A806LSU0 | 150-227 | NEENIERMVMWTPINEDTVVGEEILTDISIEEYREILHLSNIHPVIGLFPITASNQQFFQKKLRHKIDTNKYQYYLSA |
| A6XA69 | 3-83 | IQLKLTWFDKKNEDFVGKEYSQDLGYDDSIIENCGLPLDDTLNNGVFDVLDAWVPVLQGNFNHQINFDKHFYQISFDYRMT |
| A0A2A2H5M1 | 7-87 | None |
| A0A419I743 | 5-103 | None |
| A0A7W9XFK4 | 2-89 | None |
| A0A6I6A8I6 | 106-181 | None |
| A0A1H0SAR2 | 4-84 | None |
| G8T9T8 | 8-88 | None |
| A0A1D9BEL0 | 3-82 | None |
| A0A2A2GQY9 | 2-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.