DPCstruct | MC11736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 79 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A826UJU5 | 168-230 | PTLIDQGDSDQFLADQLQPAVLAEAARQKAWPMTLRIQPGYDHSYYFIASFIEDHLRFHAQHL |
| A0A3B0XDZ9 | 11-89 | YDACSLVSSGANVKDILIDQGTDDEFYEDGQLLPENFRAACDQTGQALTLRMQAGYDHSYHFIASFIGEHIAYHASALK |
| A0A7J5Y4I2 | 81-152 | None |
| A0A7J7MDD6 | 137-201 | None |
| A0A484MT61 | 84-162 | None |
| M7V0T1 | 1047-1129 | None |
| A0A1E3JPK2 | 2-85 | None |
| A0A4S4ECF9 | 76-147 | None |
| A0A3L7ICB2 | 39-129 | None |
| A0A7S4QM50 | 207-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.