DPCstruct | MC11735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 205 ± 24 aa |
| Standard deviation of domain lengths | 24.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X5MPF8 | 14-226 | PDAATLERLMDAPLPVGTRSSSTGKFEGVELTASDDSAKRHVRTCRAYADAVGEGWYAATQMDMNFEGFMRVACGSVMALAASGEAT… |
| A0A3B0XBT7 | 10-205 | NITSINSALSALNKNWYAGITVSGKGLAADKTINNCREYFDASKQGLKPVKEFERSAYYEFAIMCVAAKSITSAVPASISFLRDFVL… |
| A0A2E7FKA8 | 35-230 | None |
| F8XV02 | 6-212 | None |
| A0A495Z2E1 | 24-269 | None |
| A0A1Z3N375 | 14-204 | None |
| A0A7V8QI88 | 13-216 | None |
| A0A496BGV9 | 483-694 | None |
| A0A6B1EN78 | 896-1107 | None |
| A0A545TY66 | 175-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.