DPCstruct | MC11731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 74 ± 10 aa |
| Standard deviation of domain lengths | 9.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 56.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653C6A5 | 6-71 | PLKIELALRERSNRVGILSTIIFIKLETKAGYEISGYLDYGDKLVLENWKPIFVGHKKIMPKLTDL |
| A0A504YR44 | 1-68 | MCPVARALANREDANRSGKISTIIFIRDKNARGQEISGYIDYAHRLKTEDFTQYFTEKRKLLPRPGDL |
| A0A6P5KEP8 | 376-444 | None |
| A0A4Y2PR42 | 2-64 | None |
| A0A672GKP0 | 39-127 | None |
| A0A0R3SH35 | 90-157 | None |
| A0A556U836 | 311-387 | None |
| G7YD19 | 22-85 | None |
| A0A3P8TXD7 | 29-120 | None |
| A0A7J6P3V8 | 243-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.