DPCstruct | MC1173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N4T8M6 | 3-124 | IKALVESSTTQEDKPTADEILLYCGTTQISHEFFFNQFSLEVARGFHEQRYTYEDCDAVMNHLFNIMTTAPFFDTEINIPEPAFSIF… |
| A0A0Q8EGB1 | 2-128 | SVIEVLGELVRRAVANQPGWHISSTDMTEWVAGTGLTRDALLGDVALELARRYDADALTFEIADAVANSLHFYVTLQDANRPEVFDS… |
| A0A318B9K6 | 128-245 | None |
| A0A2A6KED5 | 1-92 | None |
| U5QF97 | 66-197 | None |
| A0A1S8GVQ9 | 8-133 | None |
| A0A1T3VGU9 | 171-287 | None |
| A0A7C1NW53 | 8-137 | None |
| A0A085K6P3 | 20-142 | None |
| A0A2T4G7R0 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.