DPCstruct | MC11729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 116 ± 20 aa |
| Standard deviation of domain lengths | 19.84 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04912 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I2V2Z2 | 1-82 | MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYE |
| A0A504YLB9 | 1-121 | MVLDPKYADLPWIAHDQPDVYEAGELPEVDQRQQMEDVENVMMPKEIETIKLSVCDAHKRFSKCKVDSSNVDFSDSIAGHGKIGYTI… |
| A0A482WRQ3 | 1-113 | None |
| A0A7J7K4G7 | 1-115 | None |
| A0A430Q0A8 | 1-150 | None |
| A0A3M6TLW5 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.