DPCstruct | MC11727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 5.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4UCX4 | 182-258 | NVFPCFPWTKKLPVQLQPDLDFLAPEYLAANQTTVTTAADVFSLGALICWICTGGSRLIDAKNNIETYLIIVGQLDT |
| A0A504YCW9 | 18-95 | DVFQNSPKFKGYQAKLPKVAQPNLDFVAPEAQLYSSMSPLADMFSVGMVICAIYNHGHSLIDCEQNPTIYARKLTEVS |
| A0A7R9KCW1 | 2-75 | None |
| A0A3B0JTH1 | 239-318 | None |
| A0A443SKP9 | 21-101 | None |
| A0A183WZ28 | 46-128 | None |
| A0A7M4FP39 | 41-116 | None |
| A0A183MQ40 | 134-205 | None |
| A0A154P0S3 | 215-291 | None |
| A0A1A9URR7 | 47-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.