DPCstruct | MC11722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 256 ± 39 aa |
| Standard deviation of domain lengths | 38.51 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 39.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S9CJR7 | 681-933 | VDQDMLETILYSRIERGVKSFFEALKISFSHPRVSGVNKIHIFLSGNSSKSVVVRELFERYVEEESHVIRESLHLEASSEIFEMFAP… |
| A0A1Q2S9P4 | 1-220 | MDDGVANFFAGFSKVMAENIDNQCRAFHIFLGGNASKSVLVKQAFENAKEKQLKAYKQRTSKDNFTFILYEPLGTEASDKQILELTG… |
| A0A839IX10 | 634-933 | None |
| J0HP57 | 192-439 | None |
| A0A2X5A6X9 | 1-248 | None |
| M5YL26 | 449-637 | None |
| A0A839ITI5 | 449-722 | None |
| A0A851IMG3 | 596-875 | None |
| J0IVI8 | 149-396 | None |
| B6JPF9 | 67-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.